PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_03052A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 247aa    MW: 25690.4 Da    PI: 8.6248
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_03052AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26053.57e-1710716146100
                     DUF260  46 lkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                l ++++++r d+++slvyeA+ r+rdPvyG++g il+lqqq++ l+aela++++ 
  Oropetium_20150105_03052A 107 LLEVQQSQRADTANSLVYEANLRLRDPVYGCMGAILTLQQQVQALEAELAAVRAD 161
                                668899********************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.99761162IPR004883Lateral organ boundaries, LOB
PfamPF031955.6E-15107159IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MSTASQWQDH ELGKKIIKRE SEAAVADRMT AAARRSCSGL PAAAGAGAAG AGPGSALNTI  60
TPCAACKLXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXLLEV QQSQRADTAN  120
SLVYEANLRL RDPVYGCMGA ILTLQQQVQA LEAELAAVRA DIVRHRYRPA AASAVLPSSH  180
ASQLLAAARG LPAARADGGA RTTATLAVGS AVGPAASSSS SSTVYAAASN STDYSSITNE  240
NVPYFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0958311e-121FP095831.1 Phyllostachys edulis cDNA clone: bphyst036h20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977134.11e-66PREDICTED: LOB domain-containing protein 15-like
TrEMBLW5AMV21e-80W5AMV2_WHEAT; Uncharacterized protein
STRINGSi012018m8e-63(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.13e-22LOB domain-containing protein 15